Table 1

 Conservation of the altered methionine residue in this patient

Part of the amino acid sequence (single-letter code) of the C-propeptides of four fibrillar pro-α1(I) collagen chains from different species and of the human fibrillar pro-α2(I) collagen chain is aligned. The bold italic letters indicate the M1264V mutation and the italic underlined letters indicate the D1277H mutation described earlier.
Human α1(I)SPEGSRKNPARTCRDLKMCHSDWKSGEYWIDPNQGCNLD
Canis familiaris α1(I)SPEGSRKNPARTCRDLKMCHSDWKSGEYWIDPNQGCNLD
Xenopus laevis α1(I)SPEGTKKNPARTCRDLKMCHSDWKSGEYWIDPNQGCILD
Trout α1(I)SPEGTKKNPARTCRDLKMCHPDWKSGEYWIDPDQGCTQD
Human α2(I)TPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMD